NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209829_10014672

Scaffold Ga0209829_10014672


Overview

Basic Information
Taxon OID3300027777 Open in IMG/M
Scaffold IDGa0209829_10014672 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4790
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (58.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002044Metagenome / Metatranscriptome599Y
F007522Metagenome / Metatranscriptome349Y
F048985Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0209829_1001467211F007522AGGMSLKEAGLWWVATMVAIIWTYGILQNAKQTHYWRGRKDGWDMHRRMIENKTDANNN
Ga0209829_100146725F048985AGGAGLPNTSQKTVTITATLLVTANRADQVVYLHSSSGTIYLGNSDVTTSTGYRMDNGDKLTMQLSDNEALYGIVSSGTATMMVMATIN
Ga0209829_100146729F002044N/AMANTRKPSKRKKINRRTVRHSPEPLSKLDQHYTALHECYKAARKAGFTPEHAFWLMTEHKTFPDWIVGDGGIIPSIDPTDDEEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.