NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209277_10399399

Scaffold Ga0209277_10399399


Overview

Basic Information
Taxon OID3300027776 Open in IMG/M
Scaffold IDGa0209277_10399399 Open in IMG/M
Source Dataset NameWastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)543
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent → Wastewater Effluent Complex Algal Communities From Wisconsin, To Seasonally Profile Nutrient Transformation And Carbon Sequestration

Source Dataset Sampling Location
Location NameMilwaukee, Wisconsin, USA
CoordinatesLat. (o)43.023Long. (o)-87.895Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F057918Metagenome / Metatranscriptome135Y

Sequences

Protein IDFamilyRBSSequence
Ga0209277_103993991F057918N/AMPKLSKKAIFIKEYEAVLASWVRKAYIRFCLDDEDSFEDKIEECMVEELAVLKSSHYVFRGSYRQWDSNWEHMLYDGKYLTDEEFLSHFCMDQSCVMQLNSLVEDDQEFRSVSGKLGKRSSMLHIVVLLKFLGRYGNEAALQKLGLMLGISKGAVNKYLRQACNAILKHCEQVIKWPSIK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.