NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209177_10340690

Scaffold Ga0209177_10340690


Overview

Basic Information
Taxon OID3300027775 Open in IMG/M
Scaffold IDGa0209177_10340690 Open in IMG/M
Source Dataset NameAgricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)584
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.8834Long. (o)-83.4195Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007547Metagenome / Metatranscriptome349Y

Sequences

Protein IDFamilyRBSSequence
Ga0209177_103406901F007547AGCAGMGGNPMQSLPPELELPEGDRFTLPTVSAVRELIPSGGQLPAHMILMMICGKELWVPLDKEIARQMANILAPFRQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.