Scaffold Ga0209433_10053398

Overview

Basic Information

• Taxon OID: 3300027774
• Scaffold ID: Ga0209433_10053398
• Source Dataset Name: Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1446
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 0.0
  • Long. (^o): -158.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072751	Metagenome	121	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209433_100533983	F072751	N/A	MKFINKEPRRTFPIPKWANNMAHEESKLWLMNNAEIHHVKELISVCEFNKLQLIERALSSPYSEFSEEECNKLFERIEVQLKDLHDHLDTIRLKNEKIQQDLGDDWLKEKH