Scaffold Ga0209433_10003484

Overview

Basic Information

• Taxon OID: 3300027774
• Scaffold ID: Ga0209433_10003484
• Source Dataset Name: Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4824
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 0.0
  • Long. (^o): -158.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093745	Metagenome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209433_100034845	F093745	AGG	MLSISEKLDNSVQIYVHCSLRDRILTLHSHSLDEYSERELELLSKIEASVSKENKKNKILELTWDDFLNNHELLNIEIILNFTNIKIDKKNELTPPNLALLIKKPEEKKLLWEKMQALLNVD