NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209088_10001979

Scaffold Ga0209088_10001979


Overview

Basic Information
Taxon OID3300027763 Open in IMG/M
Scaffold IDGa0209088_10001979 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12924
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (57.14%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004232Metagenome / Metatranscriptome447Y
F005206Metagenome / Metatranscriptome408Y
F016253Metagenome / Metatranscriptome248Y
F022877Metagenome / Metatranscriptome212N

Sequences

Protein IDFamilyRBSSequence
Ga0209088_1000197914F022877N/AEGALNENNAVIVYHSLARSWLGYWDNWIVNDFIPTSFSTFGPILMFAGDIISVSAGAGQVWSFNDYLPNSRLNPISSSAYTDGGANYQSEVITKAYNLNEPIPDKIGYSVQFAFDNPYTTATTTAEVSLAKDMSATFVTLDSALAITSSQKFLKAYNLISQGRWNTLQFKVTTDAGRLSLQSTILSGFVDSVRPQQ
Ga0209088_100019793F016253GGAGGMSDKIKSFIDSGTGVYSISKKDAGEIHKAAKKIKNYEVSYWTRNRKNKESK
Ga0209088_100019794F004232N/AMNKTIVACDPGVNGGFAIHTKDGILLFAMPKSLPDMAQLISGFKVADSHLWVEKVPKFVSNLTPSSSVATLHENYGIIQGLAYSQGYALHRVEPKVWQEPLGLGGKRSCATGPEWKRKLKSKAQELYPQLDVTLKNCDALLILHYALGGGR
Ga0209088_100019796F005206N/AMTFKVDRASAEVKPFAQPGEYIVTVNSCKDDGLDKNGNAVATLRYKGTAGEVISDRFVLKDTMMWRLQALISATEANIADGDEFDFSIGGAFLRFLQGFVGLSLVIVIEEEKYIDKHGAEQMTFRVRRMKKVPADLDGI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.