NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209296_1050363

Scaffold Ga0209296_1050363


Overview

Basic Information
Taxon OID3300027759 Open in IMG/M
Scaffold IDGa0209296_1050363 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2176
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002044Metagenome / Metatranscriptome599Y
F004599Metagenome / Metatranscriptome431N
F006539Metagenome / Metatranscriptome370Y

Sequences

Protein IDFamilyRBSSequence
Ga0209296_10503631F004599GGAMAFNLADYEDVATLNKWFISNFQSGRSDISVISHDAVNGYILVQATLWRDSKDTSPAVSNIAFGARESYIQNMKKFYVEDTATSALGRAIILLKGSDKTATKDDMKKVNDEPIKNIYGKSGNSQIIEMALRKSFADDGKSASEPTTWSVGDVAEALSTKPKQQECTHGLMILKEGTAKT
Ga0209296_10503633F006539AGGMYAQIACVYVGSDMIETTAPWIVLYSVFGYFIVWGIYSTVKDNAFQSGYWKGRKDGYDMHRRITDSKSDVYNN
Ga0209296_10503635F002044N/ADNLFMANTRKTTKRTKINRRVVRHTPDPSKIDAHYIALHECYKAARKAGFSPEHAFWLMTEIKTFPNWVVGDGGIIPSIDPSDDEDDD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.