Scaffold Ga0209296_1005100

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209296_1005100

Scaffold Ga0209296_1005100

Overview

Basic Information
Taxon OID	3300027759 Open in IMG/M
Scaffold ID	Ga0209296_1005100 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8459
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location Name	Lake Simoncouche, Canada
Coordinates	Lat. (^o)	48.2311	Long. (^o)	-71.2508	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055461	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209296_10051003	F055461	N/A	MHEDFKRDGDLYKNKNSYSIDYLKENIKDFSLWGILHTQTLTPDFCVEYLLVPDNKYAKDEEDEEIYINNVLYWQRHIVLEDLLNCDFMKKYKENNKLSSN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.