Scaffold Ga0209034_10104892

Overview

Basic Information

• Taxon OID: 3300027755
• Scaffold ID: Ga0209034_10104892
• Source Dataset Name: Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - 250m_A/KNORR_S2/LV (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 916
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -37.9983
  • Long. (^o): -44.9998
  • Depth (m): 220

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008152	Metagenome	338	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209034_101048923	F008152	AGGA	MSKEYDTLGWYKDQIERMSWDEILELMDEKIKNGSWNKFVESLGKPPHVIKHDYMLEQMN