NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209596_1099421

Scaffold Ga0209596_1099421


Overview

Basic Information
Taxon OID3300027754 Open in IMG/M
Scaffold IDGa0209596_1099421 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1376
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004111Metagenome / Metatranscriptome452Y
F013409Metagenome / Metatranscriptome271N

Sequences

Protein IDFamilyRBSSequence
Ga0209596_10994213F004111N/AMKEKIKQVNELCAANGAYINQHGKKTVSAWSKVKYFREVFGTEFGINTMIVEHSDRYVIVKCLIMGYDPERIIATGYSKQFRDKPGYIEIAETFAITRALSFMGILLEDITSKEEYEELDIPVQPMNTKGTSSAATRYDEGTINELIKKVHYAPHTAKLDFLWRANRELLDQIKIKDLATYNSILNKFNSKRDEITTQNEV
Ga0209596_10994214F013409N/ALGYKVESYDARTCDKLFDSVTYKGKTSGKNKQGTFYKSKEVFAYSCSIEKTTKGNNERKNKTG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.