| Basic Information | |
|---|---|
| Taxon OID | 3300027752 Open in IMG/M |
| Scaffold ID | Ga0209192_10050331 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1875 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Arctic Ocean: Canada Basin | |||||||
| Coordinates | Lat. (o) | 73.2247 | Long. (o) | -150.2247 | Alt. (m) | Depth (m) | 7 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001942 | Metagenome / Metatranscriptome | 613 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209192_100503315 | F001942 | N/A | MAKTSEDHQSNSRLGAVGESLVQTFLLEHCDWCYPCQEKHPADLLVELGSAKYTVQVKSRRETKEGKFTFASENSRSMSDVYKNYHCDILAFVFFRTSGTKHINFIPNISSQTYYTFNKKSINESMEINSLQDTLNQLSSIPVLNPLIK |
| ⦗Top⦘ |