NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209192_10012096

Scaffold Ga0209192_10012096


Overview

Basic Information
Taxon OID3300027752 Open in IMG/M
Scaffold IDGa0209192_10012096 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4631
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)73.2247Long. (o)-150.2247Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001521Metagenome / Metatranscriptome679Y
F020608Metagenome / Metatranscriptome223Y

Sequences

Protein IDFamilyRBSSequence
Ga0209192_1001209611F020608GGAGMDNTRNMKAIEDSKLDKITFNSLEKVERYIKELGYIFKVRDSVREDRSVIYRHKFTKKGHVFLKSSYDFLSAGSMEMGTVWTVTKF
Ga0209192_100120966F001521GGAGGMKLWITELVEDNTTAIGPYIKAETIAQANRIAIQYGLLVLGEIQELEYEVKLEERIVH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.