NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209461_10133663

Scaffold Ga0209461_10133663


Overview

Basic Information
Taxon OID3300027750 Open in IMG/M
Scaffold IDGa0209461_10133663 Open in IMG/M
Source Dataset NameAgave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)591
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Candidatus Geothermincolia → Candidatus Geothermincolales → Candidatus Geothermincolaceae → Candidatus Solincola → Candidatus Solincola sediminis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location NameGuanajuato, Mexico
CoordinatesLat. (o)21.0936Long. (o)-100.2988Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007389Metagenome / Metatranscriptome352Y

Sequences

Protein IDFamilyRBSSequence
Ga0209461_101336632F007389N/AVGRSWKRLALLGGAVLAVLLWVLGRADLVVAVLLGLLVLATGRAVFRGYSVTKGPTGPPVDVEDEGGLLVFACETCGEQLVLLRKGTDVPPRHCAEKMVLRRVPTPGSQADPRFN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.