NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209689_1009195

Scaffold Ga0209689_1009195


Overview

Basic Information
Taxon OID3300027748 Open in IMG/M
Scaffold IDGa0209689_1009195 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6677
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001727Metagenome / Metatranscriptome645Y
F006427Metagenome / Metatranscriptome373Y
F015939Metagenome / Metatranscriptome251Y

Sequences

Protein IDFamilyRBSSequence
Ga0209689_10091952F001727GGAMDRGARPPNRSLRVSPVDRLGRRISPVVLDAAEGIGRRAIEHAERLLIDPAVAAGLLEEAAATVSRALASKKNCTQANIRDLPSYLFRAFIRRVDKIKKRQLALVGDLAVPTFGSGNSTDPQASVEMKILVDELLARCDAKTREMFYRRIEGFSWKEIGRSYGISNDAAKVRFSEALRRIGEKLGLKSDL
Ga0209689_10091953F006427GAGMRLKFKDRRAFERRGNDFLDFARSYLSEAFPNPDRQGCPPDAALRSLAFNPTEGEPAMTEHLAACSPCFRRYGELLTELKAQREQEKRFSLDRIPVWTKAHPVLAGAAALCLLLIAIGVGFLLRGIRQPNTAPIDAHRKPNPTEPRNPAVAYLPFGLDLRTLSPTRGSESPATGTKRRVRVPSSPLHLTLTLPLASPEGRYELKLTAQDQTFWSKPARAHLQKGKTLIEVDADFAQIRAGNYSLEVRSSRGIRFVQMVSVQNASPPSAEQKP
Ga0209689_10091956F015939GAGGMQALRSLSGLREGPKGTFPDGTHYEYDPDLKGTVEVTPSGDRFPVALVRGELKRDSADVVARKGEAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.