NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209189_1001284

Scaffold Ga0209189_1001284


Overview

Basic Information
Taxon OID3300027747 Open in IMG/M
Scaffold IDGa0209189_1001284 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19108
Total Scaffold Genes44 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)34 (77.27%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007163Metagenome / Metatranscriptome356Y
F078376Metagenome / Metatranscriptome116Y
F096869Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0209189_10012841F096869GAGMQDFYFEKTRNSVDDDWPESFSLDDLANALNVERVSYRIYYSKDNLTCRLFVFRAHCTPTEMETMASMGFVFAQDGDTENIPDK
Ga0209189_100128441F007163GGAGMNTEDLEHIFQNQIAEGTEKLYFMLKDGDCMPMIERHPADDLAGLLPMLSSFEYAGGTANMPRFIK
Ga0209189_100128444F078376N/ALYAEAPYMQGYASGLANEEFFNPYADVENAEADAEDYERGYENAKEILVTE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.