Scaffold Ga0209908_10164677

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209908_10164677

Scaffold Ga0209908_10164677

Overview

Basic Information
Taxon OID	3300027745 Open in IMG/M
Scaffold ID	Ga0209908_10164677 Open in IMG/M
Source Dataset Name	Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	591
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location
Location Name	Sweden: Kiruna
Coordinates	Lat. (^o)	68.3534	Long. (^o)	19.0473	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095391	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209908_101646771	F095391	N/A	ECSPDLLITRTYVQGLPGHDAAVYLRTKCTKMRVLMVGGLLDDERLRYREALQGFEVYPKPYTAAELLQKVKDVLSTPRG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.