Scaffold Ga0209908_10081300

Overview

Basic Information

• Taxon OID: 3300027745
• Scaffold ID: Ga0209908_10081300
• Source Dataset Name: Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 773
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae → Aeoliella → Aeoliella mucimassa (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location

• Location Name: Sweden: Kiruna
• Coordinates
  • Lat. (^o): 68.3534
  • Long. (^o): 19.0473
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062701	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209908_100813001	F062701	N/A	LDVYKRQLQARAEQRSLSIQAVILEAIKKEIAHGPTPVEVQGRVSLPLIRSGRPGSLHSLTNAEIDDIPG