NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209908_10000171

Scaffold Ga0209908_10000171


Overview

Basic Information
Taxon OID3300027745 Open in IMG/M
Scaffold IDGa0209908_10000171 Open in IMG/M
Source Dataset NameThawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4729
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location
Location NameSweden: Kiruna
CoordinatesLat. (o)68.3534Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003988Metagenome / Metatranscriptome458Y
F006075Metagenome / Metatranscriptome382Y

Sequences

Protein IDFamilyRBSSequence
Ga0209908_100001711F006075N/AMMSEEAKKRIQIALALAVVVAGVRAGYILYERHEDYLAAQKQEQAKKAGYSNADYYVVPKKLYPFDLKSAKQLTQQPVWAKEGYRLSLIHI
Ga0209908_100001715F003988N/AVPITLAQKDYTRIVKRHYTIARIKGGMKFTCTRCAHHVSTLDFDVRRGNLRTQAATAINLHATSVHHEPVMFSSLDTQQLIWRS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.