| Basic Information | |
|---|---|
| Taxon OID | 3300027742 Open in IMG/M |
| Scaffold ID | Ga0209121_10067700 Open in IMG/M |
| Source Dataset Name | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1696 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Coal Oil Point, Santa Barbara, CA | |||||||
| Coordinates | Lat. (o) | 34.39225 | Long. (o) | -119.845662 | Alt. (m) | Depth (m) | 47 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F083665 | Metagenome | 112 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209121_100677003 | F083665 | AGGAG | MFLNFNIEKVQIEEYKHQLQWFENEFDEIFQNNSIKLTEYEKNLANALLNKLSESINQCKDEKLLYDLVSTLNSIEKKHPELF |
| ⦗Top⦘ |