Scaffold Ga0208989_10080235

Overview

Basic Information

• Taxon OID: 3300027738
• Scaffold ID: Ga0208989_10080235
• Source Dataset Name: Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1116
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location

• Location Name: El Dorado National Forest, Georgetown, California, USA
• Coordinates
  • Lat. (^o): 38.88
  • Long. (^o): -120.64

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088333	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208989_100802351	F088333	AGGAGG	MNTTKRNGHVALLLPLLLLAAGPSLRAAEKSDWGNLKQVAPGQTIKVIATDGKSSQGDFQSVSDDALVVRLAGGDRSFPRETVQRVSIKRDGHRGKHALIGAVIGAGGGLGAGIAVDHCTPTVIVCTDNKGKAILTPGFALLGAGIGALLPAGGW