NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209087_1111322

Scaffold Ga0209087_1111322


Overview

Basic Information
Taxon OID3300027734 Open in IMG/M
Scaffold IDGa0209087_1111322 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1146
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000441Metagenome / Metatranscriptome1136Y
F001019Metagenome / Metatranscriptome804Y
F023347Metagenome / Metatranscriptome210Y

Sequences

Protein IDFamilyRBSSequence
Ga0209087_11113221F023347N/AMLIAEEQLAWAQAIEDETEEAMDSMARTEAEGRLDTLVELYKLTYDLSFAIGEKEGQKV
Ga0209087_11113222F001019AGGMTYEPSLEILEVEYSCSPGGIDLFEVYDKSDIPLDIPIYETENLTEAVLFCYNLGKDFTVKTLAEWNERELAYEASR
Ga0209087_11113224F000441GAGGMRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRERIEQTDLA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.