| Basic Information | |
|---|---|
| Taxon OID | 3300027734 Open in IMG/M |
| Scaffold ID | Ga0209087_1016744 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3646 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Simoncouche, Canada | |||||||
| Coordinates | Lat. (o) | 48.2311 | Long. (o) | -71.2508 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000506 | Metagenome / Metatranscriptome | 1070 | Y |
| F003153 | Metagenome / Metatranscriptome | 504 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209087_10167442 | F003153 | AGGAG | MPVDVTGVKQLQKAMKDVEPTLNKQMSKDIKAVMLTVRDKARGYLPAQNDVLSGWGKGTASAETIKGIYRAFPAYDYALARSKVAYSAGQNKRNRSGYRAAFYVYNNSAPGAIFETAGRVNMPKGEGSLNPNAPVQFNAAAEMLTSMKGYGKQRGRVIFRAWDETKNKVIPTVVKAINTVATDFNNKTQINKAA |
| Ga0209087_10167443 | F000506 | AGGAG | MAKLKITRANGEVSEHRITPGIEFNFEAKYGSGISKVLREHERQTEIFWLAYECLRKAGAQIPIWGSEFIDTLETVEVLDEEKK |
| ⦗Top⦘ |