Basic Information | |
---|---|
Taxon OID | 3300027722 Open in IMG/M |
Scaffold ID | Ga0209819_10183303 Open in IMG/M |
Source Dataset Name | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 731 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | near Jamestown, North Dakota | |||||||
Coordinates | Lat. (o) | 47.0956 | Long. (o) | -99.1001 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046923 | Metagenome / Metatranscriptome | 150 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209819_101833032 | F046923 | N/A | YNKEHEPTVLNKGEGIMLPENHYYYFQNTGDGPLALFRVSAKKGNKPKVVRVDTEGNRRTEEENEFIVVDGTTVEGKFWELA |
⦗Top⦘ |