| Basic Information | |
|---|---|
| Taxon OID | 3300027720 Open in IMG/M |
| Scaffold ID | Ga0209617_10327178 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 569 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Erie, Canada | |||||||
| Coordinates | Lat. (o) | 41.77 | Long. (o) | -81.73 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056341 | Metagenome / Metatranscriptome | 137 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209617_103271781 | F056341 | N/A | IACRRVRKHLHYGREYVKHLVDTQAVIVKCAQEYQHKYLKSRVRKVATPSTQPYKAGDWVLAQWQGLPQGRTRPTKLSPCWRGPFSIVAVDELTQRATLRDPTDLLIMKPDVHWSQLRQYRMGLTSEADLLDLRAMDTAEDLIVRFVQHEMHYPNNSSGRLRLLPRNEWRFEAEFSDGSKQWMLWPEAK |
| ⦗Top⦘ |