NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209617_10005628

Scaffold Ga0209617_10005628


Overview

Basic Information
Taxon OID3300027720 Open in IMG/M
Scaffold IDGa0209617_10005628 Open in IMG/M
Source Dataset NameFreshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5777
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (12.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)41.77Long. (o)-81.73Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003659Metagenome / Metatranscriptome474Y
F005775Metagenome390N
F008615Metagenome / Metatranscriptome330N

Sequences

Protein IDFamilyRBSSequence
Ga0209617_1000562813F005775N/AMKKQRPIYTKAQHQIVTPAFVEKKIQMHKNVKWTTKDDRELFIMASASVTRYVPKSEHNSQAPMGFFNLQMGHYNKISVHTRDFAQLADVFEQITLFLKNNAGKLDQVVAKELDTYTTHHLKNLLNTNEQP
Ga0209617_100056284F003659GAGMPQTAADAIGRYLIAREDVPVYDLPNGTRIGTINKGNSTAEVYSYVQRPGQVWFMFDYTIPGQTPGAYYVLAKDGRFSLSTAPGNVIVSPSSLPGVDVFPAGSQLKKYAIFGALGLLALLILKK
Ga0209617_100056289F008615N/AMNRPDTFGAKMFGRFISKGWHISFTDKYQDRVCVIPPKRLDAQHVFGIYIPVLRHTWQPDLKREWWAALQTKDCMLGPKFEATAHPDDIERFAAFAAWIGDLLRNPEKFT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.