Scaffold Ga0209795_10054542

Overview

Basic Information

• Taxon OID: 3300027718
• Scaffold ID: Ga0209795_10054542
• Source Dataset Name: Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1205
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location

• Location Name: Guanajuato, Mexico
• Coordinates
  • Lat. (^o): 21.0936
  • Long. (^o): -100.2988

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002569	Metagenome / Metatranscriptome	547	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209795_100545422	F002569	AGG	MKALAQTNSILSLQFPLIRRRSPKYSLVKAKHAVPSTAEFMRVNNATVREGQAHRVWPPDVLRKFQTAEIITELKTPHYVTRDRSITPVSRSL