| Basic Information | |
|---|---|
| Taxon OID | 3300027715 Open in IMG/M |
| Scaffold ID | Ga0208665_10120024 Open in IMG/M |
| Source Dataset Name | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 816 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Ohio | |||||||
| Coordinates | Lat. (o) | 41.3769 | Long. (o) | -82.5172 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051235 | Metagenome / Metatranscriptome | 144 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208665_101200241 | F051235 | GGAGG | VVAIYTRRLSRQILGLITILLRGPLLALLSLCRFFKFNCIFTVYPGSQKDIDGYLPHGFKWVKHLASGKPFVAGVITTGNGLGRGLILAVPNTVDQFKTDRKLVGNIMKRLKHTKTLTGAKTIAVAGQGPRFFKSHFPYEQPFVYGLKGRVFSVVETVEQVSEKHGLEKYSTTVAILGVGEIGEAIIRNLEEKGYRAVGIDIQIKDGRVELCNE |
| ⦗Top⦘ |