NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209499_1003493

Scaffold Ga0209499_1003493


Overview

Basic Information
Taxon OID3300027712 Open in IMG/M
Scaffold IDGa0209499_1003493 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9549
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (76.47%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050221Metagenome145Y
F052465Metagenome / Metatranscriptome142Y

Sequences

Protein IDFamilyRBSSequence
Ga0209499_100349315F052465N/AMLTEERVNQRRVSVLERLHQRYNTLRVSRERIEILQEAKQP
Ga0209499_10034939F050221GGAGMADFTTWTQENLAQFAQDATDKLAVQHEQIQQLQCDLKDAIEAYRALIRMDVSQRDQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.