NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209499_1000569

Scaffold Ga0209499_1000569


Overview

Basic Information
Taxon OID3300027712 Open in IMG/M
Scaffold IDGa0209499_1000569 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)27112
Total Scaffold Genes41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)31 (75.61%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001091Metagenome / Metatranscriptome781Y
F066590Metagenome / Metatranscriptome126Y
F072118Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0209499_100056915F001091AGGMNIRELAKRIAIEKKLPRADKYDLFLRDFDNMVELVGLVQDPTLDMNDFRGREMLFPKRWVTLTVLPASEPVNV
Ga0209499_100056917F072118GAGMTIKLVTFKTNHTIMGEVTESSKETFITVKQPVQVVSVPPRTSTNPGSVAFSPFLEWAKEFRTGFKLNYGDILTISTPVEELENQYNQIFDSGIVVPPKKSIIT
Ga0209499_100056924F066590GGAMGTLWEKLTQFFSKRKKMPKENEDYRFIDFTDSELTGIQILKDEYAGVVYHYGKVRVKEQGEMGVLEFGYTLVNPGKHDINLLQKDDNFVTIMGDILTEILTKQANETIRKNDTEEFNL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.