NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209599_10200558

Scaffold Ga0209599_10200558


Overview

Basic Information
Taxon OID3300027710 Open in IMG/M
Scaffold IDGa0209599_10200558 Open in IMG/M
Source Dataset NameSubsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)539
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameOhio, USA
CoordinatesLat. (o)39.849Long. (o)-81.036Alt. (m)Depth (m)2500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082391Metagenome / Metatranscriptome113Y
F085595Metagenome / Metatranscriptome111N

Sequences

Protein IDFamilyRBSSequence
Ga0209599_102005581F082391GGAGGVDEKDIKVPRSVHFADFLVVLAGLVHNISSSIHTATEELMEIAVYNANRNSEVNKVWEQFSNDLEKIQ
Ga0209599_102005582F085595N/AAPGTPAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.