| Basic Information | |
|---|---|
| Taxon OID | 3300027710 Open in IMG/M |
| Scaffold ID | Ga0209599_10016756 Open in IMG/M |
| Source Dataset Name | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2114 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ohio, USA | |||||||
| Coordinates | Lat. (o) | 39.849 | Long. (o) | -81.036 | Alt. (m) | Depth (m) | 2500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005475 | Metagenome / Metatranscriptome | 399 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209599_100167561 | F005475 | N/A | MGVISTQGFTFRLLAGEPYQQLDVFADEDILMSNNVTGLFDIGVLPSEFTRQITLPGSKVNNAFFEHVYDISIDSPFLFATNQKVPALFEFDSVYLSQGYLQLNKVNVIANKFIDSYE |
| ⦗Top⦘ |