NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209445_1206620

Scaffold Ga0209445_1206620


Overview

Basic Information
Taxon OID3300027700 Open in IMG/M
Scaffold IDGa0209445_1206620 Open in IMG/M
Source Dataset NameMarine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - NADW_A/KNORR_S2/LV (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)532
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-37.9728Long. (o)-44.9905Alt. (m)Depth (m)2502
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082916Metagenome113N

Sequences

Protein IDFamilyRBSSequence
Ga0209445_12066202F082916N/AEKRIQKNKLRPGNKRVIPKANLENIKFGRFKGSKDSLYNRYKIIFDDIELRTVINFSDNDWEKTIEFEKIIKNSCFGNYKKLINTLEWLDDKNINMDIAEKLIFTEYKQYIQKNN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.