NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209033_1050571

Scaffold Ga0209033_1050571


Overview

Basic Information
Taxon OID3300027697 Open in IMG/M
Scaffold IDGa0209033_1050571 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1497
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001298Metagenome / Metatranscriptome727Y
F017613Metagenome / Metatranscriptome239Y

Sequences

Protein IDFamilyRBSSequence
Ga0209033_10505711F001298GGGGGLCPFAKARKDVSLYSEFLPDAKEILADLGVAGSCNNGAITFVCMLSDPAMTQSFEAGGFKEQTQHTVRLAAATASWSLPDGSNGASAAVISGGAPIASLAIGKKIVAGGKTLRITGQTY
Ga0209033_10505712F017613N/AMANSITAAPAVLAEGVIGSLKNKLPVLSGISTVFSSRPGVNGLSIQVPLIGTSTATTFGASGYLTQDDATVTSATVTLVHYKVSSRFSPSNLKEYGAQFFVNNFVQTASIALAQKVMDVINAQVTNANYSTSSTSGADLSYAELVAVQKTLDDAKAPSPRYAVLNSTYVSDLRKDTTIVGNNVLGANIIRDGDLGVIAGARVYQFANLAANSENLAGWVAGPDAIAFASALPETEIPGWEVANAIDPETGLGVQVIMGQEQSGYMNVTATLLAGAAVGRATSLVRLKTA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.