Basic Information | |
---|---|
Taxon OID | 3300027695 Open in IMG/M |
Scaffold ID | Ga0209966_1169665 Open in IMG/M |
Source Dataset Name | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 511 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere → Arabidopsis Thaliana Rhizosphere Microbial Communities From The Joint Genome Institute, Usa, That Affect Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Joint Genome Institute, California, USA | |||||||
Coordinates | Lat. (o) | 37.931388 | Long. (o) | -122.021761 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042001 | Metagenome / Metatranscriptome | 159 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209966_11696651 | F042001 | N/A | VSSHPIKNGWLEVQSGGGNGRVYWNYHEVPQFSQLPTAGFNTAMTGTFMFKPGIDNLSIKDGNHNTGGWSLEGQYAFGGFGLAFHRTDVESKAEYWHNNQGNGISVSYPNGLQLVDNKEYKFFMTLVTDRAKQEVVLNAWLDFGDGKGWIQVMKDRKWGQSGWSPGSVPN |
⦗Top⦘ |