| Basic Information | |
|---|---|
| Taxon OID | 3300027690 Open in IMG/M |
| Scaffold ID | Ga0209164_1001296 Open in IMG/M |
| Source Dataset Name | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 33787 |
| Total Scaffold Genes | 63 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 56 (88.89%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Enrichment Culture Microbial Communities From Rutgers University That Are Mtbe-Degrading |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New York Harbor | |||||||
| Coordinates | Lat. (o) | 40.67 | Long. (o) | -74.01 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050784 | Metagenome | 145 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209164_100129655 | F050784 | AGGAGG | MMELWTGPEFTKHNRGRMGVMGSVATLLGVAFAIVGIISEASLTLLGLFPTSWYLLAIASLIFSLGCWLGWAVGIYLHARETESKE |
| ⦗Top⦘ |