NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209710_1007064

Scaffold Ga0209710_1007064


Overview

Basic Information
Taxon OID3300027687 Open in IMG/M
Scaffold IDGa0209710_1007064 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6781
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)75.235Long. (o)-150.0691Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028142Metagenome / Metatranscriptome192N
F066693Metagenome / Metatranscriptome126N

Sequences

Protein IDFamilyRBSSequence
Ga0209710_100706411F028142N/AMRINELIAQPNDMDHMIQRVGVIADICNTMGNKPLMYRQVKGVINNAYKFVVKVTPEENREINGNQKNPAQQNVIQKLGIKNPVWATMEPAPGTSGPFGENNIMIPVGNYQIHHSSEVQDLGRKDDVEQFMDTYKTGWPDPSHGDNEVIVDCVNYYLINVGAFVGKYAGKKAKAILAINRSKGYYSDWDNLNKEMLKAKFGTYKDVGWYLSNPVTNYLKWMDENQKKRSADARADAAKGVDPYKDAFWNKK
Ga0209710_10070642F066693AGGAMKLSCSTLYISHPTAIRHGPLGVNKQSRQSIIEHFLKLKKEGQPTNESWKTGHDIHLDHDILNPLLDQIHLWYCHNVVGPRGPKFITDQVWSDTYNLDIDAEVWFQESLPGQGCPQHEHGTLSRCSWVYYLDVGESNNPLTFVEMQESKNEIFPVDEINLPVYNDMVVMFPSTIHHKVYPVNTTRYILAGNINDITYRENK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.