| Basic Information | |
|---|---|
| Taxon OID | 3300027682 Open in IMG/M |
| Scaffold ID | Ga0209971_1011229 Open in IMG/M |
| Source Dataset Name | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2121 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere → Arabidopsis Thaliana Rhizosphere Microbial Communities From The Joint Genome Institute, Usa, That Affect Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Joint Genome Institute, California, USA | |||||||
| Coordinates | Lat. (o) | 37.931388 | Long. (o) | -122.021761 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003296 | Metagenome / Metatranscriptome | 495 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209971_10112293 | F003296 | N/A | RMQVLQRLDLFTDTGMRDQLGARLQPIVDRASAELVETINHQLGELVRGYVAEAIEREIESWRKRSG |
| ⦗Top⦘ |