Scaffold Ga0207826_1011423

Overview

Basic Information

• Taxon OID: 3300027680
• Scaffold ID: Ga0207826_1011423
• Source Dataset Name: Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2414
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium macuxiense (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location

• Location Name: Luquillo Experimental Forest Soil, Puerto Rico
• Coordinates
  • Lat. (^o): 18.0
  • Long. (^o): -65.0
  • Depth (m): .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006947	Metagenome	361	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207826_10114234	F006947	GGAGG	VNFQSVRTRHPLASVTSDGDFAYVQVGCGHVTCKREGDRIVVVAGPGCQLAASGGLDIVAVVVSSKEDEKH