Scaffold Ga0209423_10061062

Overview

Basic Information

• Taxon OID: 3300027670
• Scaffold ID: Ga0209423_10061062
• Source Dataset Name: Nasutitermes corniger crop gut microbial community from laboratory colony in Florida, USA - Nc150C (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1489
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: laboratory colony in Florida, USA
• Coordinates
  • Lat. (^o): 26.0625
  • Long. (^o): -80.2332

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010925	Metagenome	297	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209423_100610621	F010925	N/A	AGYTLHDHKTNDSVRRELQTECILDKIDEYRRNWFLLL