Scaffold Ga0209423_10020134

Overview

Basic Information

• Taxon OID: 3300027670
• Scaffold ID: Ga0209423_10020134
• Source Dataset Name: Nasutitermes corniger crop gut microbial community from laboratory colony in Florida, USA - Nc150C (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2052
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: laboratory colony in Florida, USA
• Coordinates
  • Lat. (^o): 26.0625
  • Long. (^o): -80.2332

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008853	Metagenome	327	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209423_100201343	F008853	N/A	GGEYHRLHVQFRPPDDGPVRPETCRGKRIADIVRRRKTVYQVGNIEK