Scaffold Ga0208960_1046030

Overview

Basic Information

• Taxon OID: 3300027649
• Scaffold ID: Ga0208960_1046030
• Source Dataset Name: Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1430
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location

• Location Name: Great Lakes, Michigan, USA
• Coordinates
  • Lat. (^o): 44.701094
  • Long. (^o): -82.854085

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078623	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208960_10460305	F078623	N/A	MRDTIIIHNIHDKASREFVAAYGNRNDVTVLEDDGLHVRLTFPYISAFPTVVIPTPSYENTDENGVVTKIDGSIEYLRAPEDWNTVQTRIDYWENKVPNWKQTDSRYTQ