NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209117_1115154

Scaffold Ga0209117_1115154


Overview

Basic Information
Taxon OID3300027645 Open in IMG/M
Scaffold IDGa0209117_1115154 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)723
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069023Metagenome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0209117_11151541F069023N/AMPDSEAQERLRLLETEIERRLSERFAALREEFDRMRLETDRRWYGFLERFDQDLKGVVPADLLGAEGAKTTAQSPGHGLVSVGAVRALDQAGTQVDVLHRYLDECRRHCSRAALLVARGGSIGAWKAIGFSAHGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.