NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209356_1009027

Scaffold Ga0209356_1009027


Overview

Basic Information
Taxon OID3300027644 Open in IMG/M
Scaffold IDGa0209356_1009027 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3563
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003962Metagenome / Metatranscriptome459Y
F065536Metagenome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0209356_10090271F065536N/AMDEISAPPSAPIEKAKNGRDIFTDKIADEIVAACGSGFTLEKAGALVGVNPSTIRTWAQRKPDFGKRVETARKKHELSLLRDVQLAGEKSWQAKAWILERGYNWAQPSARLNVTQDVTHGLSSNLASLLAGIAGRKKITVTPEKRQIESGHNYIDVQPVATKPENHLSNNKYCINKTNSVEQQQDAQAKTPKPRHKRMKLRKPRAESLAKYPPTTTPP
Ga0209356_100902710F003962N/AQKKVGLPLDREQLKLAHKFIGLLQAENAQLHSVLRLLGQLVDDMNANCSYEVFEAQWNGLTERVRGLSSFFESHQKALQSLQDACPDEFDTDEVDEA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.