NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209076_1003395

Scaffold Ga0209076_1003395


Overview

Basic Information
Taxon OID3300027643 Open in IMG/M
Scaffold IDGa0209076_1003395 Open in IMG/M
Source Dataset NameVadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3600
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameEel River Critical Zone Observatory, California, USA
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002025Metagenome / Metatranscriptome603Y
F063394Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0209076_10033953F002025AGGAGGMNNQVLKYITQARASFLLGLSEADLSRISKESGLGHVERAGNQEETYFTYEELQRICMLAAHQMQTVH
Ga0209076_10033954F063394AGGAMQGMMLRDARNGQFEWRNTIAPLLGDWVVLLAMKHRRAPLPVPSALWKGLLREGFPNDLDELAILARRYLFLGDARILLAELRIRTAATASVRETLSKEDKIAAEDRPQNICQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.