NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208827_1141647

Scaffold Ga0208827_1141647


Overview

Basic Information
Taxon OID3300027641 Open in IMG/M
Scaffold IDGa0208827_1141647 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)675
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004890Metagenome / Metatranscriptome420Y

Sequences

Protein IDFamilyRBSSequence
Ga0208827_11416471F004890AGGGGGMSSSRKEVLSDALKAEAGAASVDLETLFTGDVVGWSPYVTVSGLTAVAALSALREAAFSNVVITYRGLDEVGNKAFAEWLV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.