Basic Information | |
---|---|
Taxon OID | 3300027638 Open in IMG/M |
Scaffold ID | Ga0208612_1171166 Open in IMG/M |
Source Dataset Name | Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 523 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Antarctic Dry Valleys | |||||||
Coordinates | Lat. (o) | -78.1358 | Long. (o) | 164.1187 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082143 | Metagenome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208612_11711661 | F082143 | AGGAG | LLENTGRLTAQLRAASGRSSKLIKDSDGFEAVVEVPGRGTLTLSVRRGGGYSLRVRSEADAQEDEAEGRDLVAVGVIGA |
⦗Top⦘ |