| Basic Information | |
|---|---|
| Taxon OID | 3300027638 Open in IMG/M |
| Scaffold ID | Ga0208612_1169635 Open in IMG/M |
| Source Dataset Name | Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 526 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctic Dry Valleys | |||||||
| Coordinates | Lat. (o) | -78.1358 | Long. (o) | 164.1187 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016525 | Metagenome / Metatranscriptome | 246 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208612_11696352 | F016525 | N/A | REFMEMERREIKQRQDGQLARHLGAPLPGELPAALRQLAAHDQTQAKRGLVALMSGGTTVYKPLEDLQPEDMPARIAANRLRITWLKERRDEWLGRGETPA |
| ⦗Top⦘ |