Scaffold Ga0208612_1108752

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208612_1108752

Scaffold Ga0208612_1108752

Overview

Basic Information
Taxon OID	3300027638 Open in IMG/M
Scaffold ID	Ga0208612_1108752 Open in IMG/M
Source Dataset Name	Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	712
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location
Location Name	Antarctic Dry Valleys
Coordinates	Lat. (^o)	-78.1358	Long. (^o)	164.1187	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034818	Metagenome / Metatranscriptome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208612_11087521	F034818	GAGG	VERRHEEAVARQESMVDELRKAELVRDRLEGLDQSAKAYPEGHRMRVLVEGLGVDQALRVVEEEVRTLRDALLYPRGT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.