Scaffold Ga0208612_1011658

Overview

Basic Information

• Taxon OID: 3300027638
• Scaffold ID: Ga0208612_1011658
• Source Dataset Name: Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3033
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location

• Location Name: Antarctic Dry Valleys
• Coordinates
  • Lat. (^o): -78.1358
  • Long. (^o): 164.1187
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069899	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208612_10116581	F069899	GGA	MAITSRVAGIADRLRAQRRSHADADSVAAELRAHYPDGDVELTKRAYAYA