Scaffold Ga0208133_1049303

Overview

Basic Information

• Taxon OID: 3300027631
• Scaffold ID: Ga0208133_1049303
• Source Dataset Name: Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1020
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Columbia River Estuary
• Coordinates
  • Lat. (^o): 46.234
  • Long. (^o): -123.9135

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064723	Metagenome / Metatranscriptome	128	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208133_10493032	F064723	N/A	MFISQAKLNRLKRLEGKTNKKGQPLATSNFANSVIELDNIMQQITITKRKEITKAAEPIALAAYRNHVEISTKPHKFYVKGKGLKYNIMPGNLRRSIQIVSDVKNFKYLTSAIGPLYKDAGSGVTLSSEAKADGFYAHMIYGSTKAWVKRVKNLAERASQMAVINKMSGEALKMAKQYPRKFWEL